ME1 antibody

Catalog No. ABIN631513

This Rabbit Polyclonal antibody specifically detects ME1 in WB. It exhibits reactivity toward Human.

Quick Overview for ME1 antibody (ABIN631513)

Target: ME1 (Malic Enzyme 1, NADP(+)-Dependent, Cytosolic (ME1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ME1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ME1 Antibody

Purification: Affinity purified

Immunogen: ME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ME1 Blocking Peptide, (ABIN5614715), is also available for use as a blocking control in assays to test for specificity of this ME1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ME1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ME1

Target: ME1 (Malic Enzyme 1, NADP(+)-Dependent, Cytosolic (ME1))

Alternative Name: ME1

Background: ME1 is a cytosolic, NADP-dependent enzyme that generates NADPH for fatty acid biosynthesis. The activity of this enzyme, the reversible oxidative decarboxylation of malate, links the glycolytic and citric acid cycles. The regulation of expression for this gene is complex. Increased expression can result from elevated levels of thyroid hormones or by higher proportions of carbohydrates in the diet.

Molecular Weight: 64 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha