Add to Basket
Order hotline:
 |
+1 404 474 4654 |
 |
+1 888 205 9894 (TF) |
Catalase (CAT) antibody
| Antigen | Catalase (CAT) |
| Synonyms |
MGC138422, MGC138424, Cas1, Cs-1, Cas-1, 2210418N07, CS1, RATCATL, RATCAT01, fb68a12, wu:fb68a12, CAT, CATA, CT21282, DMCATHPO, DROCATHPO, U00145, bs36h11.y1, DmelCG6871, CG6871, MGC128112, CATALASE, ...
show more
|
| Clonality | Polyclonal |
| Host |
 Alternatives Rabbit |
| Application |
Alternatives Western Blotting (WB)
|
| Catalog no. | ABIN631595 |
| Quantity | 50 ug (1 mg/ml) (Variants) |
| Price | 478.33 $ Plus shipping costs $35.00 |
| Shipping to |
|
| Availability | Ships within 5 to 7 Business Days |
Additional Information
| Alternative name | Catalase |
| Immunogen | Catalase antibody was raised using the middle region of CAT corresponding to a region with amino acids LKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSG |
| Description | This gene encodes catalase, a key antioxidant enzyme in the bodies defense against oxidative stress. Catalase is a heme enzyme that is present in the peroxisome of nearly all aerobic cells. |
| Molecular Weight | 58 kDa (MW of target protein) |
| Synonyms | MGC138422, MGC138424, Cas1, Cs-1, Cas-1, 2210418N07, CS1, RATCATL, RATCAT01, fb68a12, wu:fb68a12, CAT, CATA, CT21282, DMCATHPO, DROCATHPO, U00145, bs36h11.y1, DmelCG6871, CG6871, MGC128112, CATALASE, CATALASE 2, T12J5.2, Cat, GB11648, catalase, MGC147040, DKFZp469E0232 |
Application Details
| Concentration | 1 mg/ml |
| Purification | Affinity purified |
| Buffer | Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CAT antibody in PBS |
| Storage | Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles. |
| Research Area | Cancer, Organelles, Heat Shock Proteins, Cell/Tissue Markers |
| Restrictions | For Research Use only |
Alternatives
Alternatives for antigen "Catalase (CAT)", type "Antibodies"
