PCSK4 antibody (N-Term)

Catalog No. ABIN631599

The Rabbit Polyclonal anti-PCSK4 antibody (ABIN631599) specifically detects PCSK4 in WB. The antibody is reactive with Human samples.

Quick Overview for PCSK4 antibody (N-Term) (ABIN631599)

Target: PCSK4 (Proprotein Convertase Subtilisin/kexin Type 4 (PCSK4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCSK4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PCSK4 Antibody

Binding Specificity: N-Term

Specificity: PCSK4 antibody was raised against the N terminal of PCSK4

Purification: Affinity purified

Immunogen: PCSK4 antibody was raised using the N terminal of PCSK4 corresponding to a region with amino acids VSSWAVQVSQGNREVERLARKFGFVNLGPIFPDGQYFHLRHRGVVQQSLT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCSK4 Blocking Peptide, (ABIN5615264), is also available for use as a blocking control in assays to test for specificity of this PCSK4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCSK4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCSK4

Target: PCSK4 (Proprotein Convertase Subtilisin/kexin Type 4 (PCSK4))

Alternative Name: PCSK4

Background: PCSK4 is involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. PCSK4 plays a role in transcriptional coactivation. PCSK4 may be involved in stabilizing the multiprotein transcription complex.Proprotein convertases, including PCSK4, are calcium-dependent serine proteases related to bacterial subtilisins and to yeast kexin.

Molecular Weight: 83 kDa (MW of target protein)