USP22 antibody (N-Term)

Catalog No. ABIN631622

The Rabbit Polyclonal anti-USP22 antibody is suitable to detect USP22 in samples from Human. It has been validated for WB.

Quick Overview for USP22 antibody (N-Term) (ABIN631622)

Target: USP22 (Ubiquitin Specific Peptidase 22 (USP22))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This USP22 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-USP22 Antibody

Binding Specificity: N-Term

Specificity: USP22 antibody was raised against the N terminal of USP22

Purification: Affinity purified

Immunogen: USP22 antibody was raised using the N terminal of USP22 corresponding to a region with amino acids RLHSCLYCVFFGCFTKKHIHEHAKAKRHNLAIDLMYGGIYCFLCQDYIYD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

USP22 Blocking Peptide, (ABIN5616933), is also available for use as a blocking control in assays to test for specificity of this USP22 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of USP22 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for USP22

Target: USP22 (Ubiquitin Specific Peptidase 22 (USP22))

Alternative Name: USP22

Background: USP22 is a subunit of the SAGA transcriptional cofactor complex. It deubiquitylates histone H2B and is recruited to specific genes by activators like Myc. USP22 is needed for cell cycle progression. It deubiquitylates histone H2A in addition to H2B. Altered mRNA expression is associated with therapy failure and death in patients multiple types of cancer.

Molecular Weight: 60 kDa (MW of target protein)