NEDD4 antibody (Middle Region)

Catalog No. ABIN631663

This Rabbit Polyclonal antibody specifically detects NEDD4 in WB. It exhibits reactivity toward Human.

Quick Overview for NEDD4 antibody (Middle Region) (ABIN631663)

Target: NEDD4 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 4, E3 Ubiquitin Protein Ligase (NEDD4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NEDD4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NEDD4 Antibody

Binding Specificity: Middle Region

Specificity: NEDD4 antibody was raised against the middle region of NEDD4

Purification: Affinity purified

Immunogen: NEDD4 antibody was raised using the middle region of NEDD4 corresponding to a region with amino acids SRRGSLQAYTFEEQPTLPVLLPTSSGLPPGWEEKQDERGRSYYVDHNSRT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NEDD4 Blocking Peptide, (ABIN5614952), is also available for use as a blocking control in assays to test for specificity of this NEDD4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEDD4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NEDD4

Target: NEDD4 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 4, E3 Ubiquitin Protein Ligase (NEDD4))

Alternative Name: NEDD4

Background: NEDD4 is an E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. NEDD4 is involved in the budding of many viruses.

Molecular Weight: 104 kDa (MW of target protein)

Pathways: Notch Signaling, Intracellular Steroid Hormone Receptor Signaling Pathway, Skeletal Muscle Fiber Development, Signaling Events mediated by VEGFR1 and VEGFR2