Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (Non-Specific Cross Reacting Antigen) (CEACAM6) antibody

Antigen

Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (Non-Specific Cross Reacting Antigen) (CEACAM6)

Synonyms NCA, CEAL, CD66c
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN631672
Quantity 50 ug  (1 mg/ml)  (Variants)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name CEACAM6
Immunogen CEACAM6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVI
Description Many breast, pancreatic, colonic and non-small-cell lung carcinoma lines express CEACAM6 and CEACAM5, and antibodies to both can affect tumor cell growth in vitro and in vivo.
Molecular Weight 33 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CEACAM6 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Restrictions For Research Use only

Alternatives

Alternatives for antigen "Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (Non-Specific Cross Reacting Antigen) (CEACAM6)", type "Antibodies"
Hosts Rabbit (5), Mouse (4)
Reactivities Human (8)
Applications Western Blotting (WB) (9), ELISA (3), Immunohistochemistry (IHC) (3), Flow Cytometry (FACS) (2), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2), Cell-ELISA (cELISA) (1), ELISA (Detection) (1), Enzyme Immunoassay (EIA) (1), Immunocytochemistry (ICC) (1), Immunohistochemistry (Frozen Sections) (IHC (fro)) (1), Immunoprecipitation (IP) (1)