Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Guanine Nucleotide Binding Protein (G Protein) alpha 12 (GNA12) antibody

Antigen

Guanine Nucleotide Binding Protein (G Protein) alpha 12 (GNA12)

Synonyms RMP, gep, NNX3, MGC99644, MGC104623
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN631704
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name GNA12
Immunogen GNA12 antibody was raised using a synthetic peptide corresponding to a region with amino acids TFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYF
Description GNA12 belongs to the G-alpha family. G(12) subfamily. Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
Molecular Weight 44 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GNA12 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Restrictions For Research Use only

Alternatives

Alternatives for antigen "Guanine Nucleotide Binding Protein (G Protein) alpha 12 (GNA12)", type "Antibodies"
Hosts Rabbit (7), Mouse (3)
Reactivities Human (10)
Applications Western Blotting (WB) (7), Enzyme Immunoassay (EIA) (4), ELISA (3), ELISA (Detection) (3), Dot Blot (Dot) (2)
Epitopes pSer67 (3), S67 (1)