Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

3'(2'), 5'-Bisphosphate Nucleotidase 1 (BPNT1) antibody

Antigen

3'(2'), 5'-Bisphosphate Nucleotidase 1 (BPNT1)

Synonyms PIP, BPntase, Sal3, MGC93112, MGC82412, BPNT1, MGC126947
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN631707
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name BPNT1
Immunogen BPNT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIP
Description BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity.
Molecular Weight 29 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BPNT1 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Neurology, DNA/RNA
Restrictions For Research Use only

Alternatives

Alternatives for antigen "3'(2'), 5'-Bisphosphate Nucleotidase 1 (BPNT1)", type "Antibodies"
Hosts Mouse (6), Goat (4), Rabbit (1)
Reactivities Human (10)
Applications Western Blotting (WB) (10), Enzyme Immunoassay (EIA) (5), ELISA (4), Immunofluorescence (IF) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), ELISA (Detection) (1)
Epitopes C-Term (1)