SAR1B antibody

Catalog No. ABIN631740

The Rabbit Polyclonal anti-SAR1B antibody (ABIN631740) specifically detects SAR1B in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for SAR1B antibody (ABIN631740)

Target: SAR1B (SAR1 Homolog B (SAR1B))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SAR1B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SAR1B Antibody

Purification: Affinity purified

Immunogen: SAR1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids RLLESKEELDSLMTDETIANVPILILGNKIDRPEAISEERLREMFGLYGQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SAR1B Blocking Peptide, (ABIN5615997), is also available for use as a blocking control in assays to test for specificity of this SAR1B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SAR1B

Target: SAR1B (SAR1 Homolog B (SAR1B))

Alternative Name: SAR1B

Background: SAR1B is involved in transport from the endoplasmic reticulum to the Golgi apparatus. SAR1B is activated by the guanine nucleotide exchange factor PREB. SAR1B is involved in the selection of the protein cargo and the assembly of the COPII coat complex.

Molecular Weight: 22 kDa (MW of target protein)

Pathways: Lipid Metabolism