KHDRBS2 antibody (Middle Region)

Catalog No. ABIN631800

The Rabbit Polyclonal anti-KHDRBS2 antibody (ABIN631800) specifically detects KHDRBS2 in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for KHDRBS2 antibody (Middle Region) (ABIN631800)

Target: KHDRBS2 (KH Domain Containing, RNA Binding, Signal Transduction Associated 2 (KHDRBS2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KHDRBS2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KHDRBS2 Antibody

Binding Specificity: Middle Region

Specificity: KHDRBS2 antibody was raised against the middle region of KHDRBS2

Purification: Affinity purified

Immunogen: KHDRBS2 antibody was raised using the middle region of KHDRBS2 corresponding to a region with amino acids EAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSEDSGRGRGIRG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KHDRBS2 Blocking Peptide, (ABIN937678), is also available for use as a blocking control in assays to test for specificity of this KHDRBS2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KHDRBS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KHDRBS2

Target: KHDRBS2 (KH Domain Containing, RNA Binding, Signal Transduction Associated 2 (KHDRBS2))

Alternative Name: KHDRBS2

Background: KHDRBS2 is a RNA-binding protein that plays a role in the regulation of alternative splicing and influences mRNA splice site selection and exon inclusion. Its phosphorylation by FYN inhibits its ability to regulate splice site selection.

Molecular Weight: 39 kDa (MW of target protein)