CPN2 antibody (N-Term)

Catalog No. ABIN631849

This Rabbit Polyclonal antibody specifically detects CPN2 in WB. It exhibits reactivity toward Human.

Quick Overview for CPN2 antibody (N-Term) (ABIN631849)

Target: CPN2 (Carboxypeptidase N Subunit 2 (CPN2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CPN2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CPN2 Antibody

Binding Specificity: N-Term

Specificity: Carboxypeptidase N2 antibody was raised against the N terminal of CPN2

Purification: Affinity purified

Immunogen: Carboxypeptidase N2 antibody was raised using the N terminal of CPN2 corresponding to a region with amino acids FTTLETRAFGSNPNLTKVVFLNTQLCQFRPDAFGGLPRLEDLEVTGSSFL

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Carboxypeptidase N2 Blocking Peptide, (ABIN938489), is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase N2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CPN2

Target: CPN2 (Carboxypeptidase N Subunit 2 (CPN2))

Alternative Name: Carboxypeptidase N2

Background: CPN2 contains 13 LRR (leucine-rich) repeats. The 83 kDa subunit binds and stabilizes the catalytic subunit at 37 degrees Celsius and keeps it in circulation. Under some circumstances it may be an allosteric modifier of the catalytic subunit.

Molecular Weight: 60 kDa (MW of target protein)