TMEM184A antibody (C-Term)

Catalog No. ABIN631931

The Rabbit Polyclonal anti-TMEM184A antibody is suitable to detect TMEM184A in samples from Human. It has been validated for WB.

Quick Overview for TMEM184A antibody (C-Term) (ABIN631931)

Target: TMEM184A (Transmembrane Protein 184A (TMEM184A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM184A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TMEM184A Antibody

Binding Specificity: C-Term

Specificity: TMEM184 A antibody was raised against the C terminal of TMEM184

Purification: Affinity purified

Immunogen: TMEM184 A antibody was raised using the C terminal of TMEM184 corresponding to a region with amino acids CQVYAEKKENSPAPPAPMQSISSGIRETVSPQDIVQDAIHNFSPAYQHYT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM184A Blocking Peptide, (ABIN937174), is also available for use as a blocking control in assays to test for specificity of this TMEM184A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM180 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM184A

Target: TMEM184A (Transmembrane Protein 184A (TMEM184A))

Alternative Name: TMEM184A

Background: TMEM184A is a multi-pass membrane proteinPotential. It belongs to the UPF0206 family. The exact function of TMEM184A remains unknown.

Molecular Weight: 46 kDa (MW of target protein)