FANCL antibody (Middle Region)

Catalog No. ABIN631983

The Rabbit Polyclonal anti-FANCL antibody (ABIN631983) specifically detects FANCL in WB. The antibody is reactive with Human samples.

Quick Overview for FANCL antibody (Middle Region) (ABIN631983)

Target: FANCL (Fanconi Anemia, Complementation Group L (FANCL))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FANCL antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FANCL Antibody

Binding Specificity: Middle Region

Specificity: FANCL antibody was raised against the middle region of FANCL

Purification: Affinity purified

Immunogen: FANCL antibody was raised using the middle region of FANCL corresponding to a region with amino acids ASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQVNSPQSSLISIY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FANCL Blocking Peptide, (ABIN936892), is also available for use as a blocking control in assays to test for specificity of this FANCL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FANCL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FANCL

Target: FANCL (Fanconi Anemia, Complementation Group L (FANCL))

Alternative Name: FANCL

Background: The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: DNA Damage Repair