Carabin antibody (N-Term)

Catalog No. ABIN632014

This Rabbit Polyclonal antibody specifically detects Carabin in WB. It exhibits reactivity toward Human.

Quick Overview for Carabin antibody (N-Term) (ABIN632014)

Target: Carabin (TBC1D10C) (TBC1 Domain Family, Member 10C (TBC1D10C))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Carabin antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Carabin Antibody

Binding Specificity: N-Term

Specificity: TBC1 D11 antibody was raised against the N terminal of TBC1 11

Purification: Affinity purified

Immunogen: TBC1 D11 antibody was raised using the N terminal of TBC1 11 corresponding to a region with amino acids MAQALGEDLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TBC1D10C Blocking Peptide, (ABIN5616512), is also available for use as a blocking control in assays to test for specificity of this TBC1D10C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Carabin

Target: Carabin (TBC1D10C) (TBC1 Domain Family, Member 10C (TBC1D10C))

Alternative Name: TBC1D10C

Background: TBC1D10C inhibits the Ras signaling pathway through its intrinsic Ras GTPase-activating protein (GAP) activity. TBC1D10C acts as a negative feedback inhibitor of the calcineurin signaling pathway that also mediates crosstalk between calcineurin and Ras.

Molecular Weight: 50 kDa (MW of target protein)