ASPRV1 antibody (Middle Region)

Catalog No. ABIN632022

The Rabbit Polyclonal anti-ASPRV1 antibody (ABIN632022) specifically detects ASPRV1 in WB. The antibody is reactive with Human samples.

Quick Overview for ASPRV1 antibody (Middle Region) (ABIN632022)

Target: ASPRV1 (Aspartic Peptidase, Retroviral-Like 1 (ASPRV1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ASPRV1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ASPRV1 Antibody

Binding Specificity: Middle Region

Specificity: SASP antibody was raised against the middle region of Sasp

Purification: Affinity purified

Immunogen: SASP antibody was raised using the middle region of Sasp corresponding to a region with amino acids RGEALGVYNRLSPQDQGDYGTVKEALLKAFGVPGAAPSHLPKEIVFANSM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SASP Blocking Peptide, (ABIN5616000), is also available for use as a blocking control in assays to test for specificity of this SASP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SASP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ASPRV1

Target: ASPRV1 (Aspartic Peptidase, Retroviral-Like 1 (ASPRV1))

Alternative Name: SASP

Background: The specific function of SASP is not yet known.

Molecular Weight: 37 kDa (MW of target protein)

Pathways: Carbohydrate Homeostasis, Cell RedoxHomeostasis