MAT2B antibody (Middle Region)

Catalog No. ABIN632028

The Rabbit Polyclonal anti-MAT2B antibody (ABIN632028) specifically detects MAT2B in WB. The antibody is reactive with Human samples.

Quick Overview for MAT2B antibody (Middle Region) (ABIN632028)

Target: MAT2B (Methionine Adenosyltransferase II, beta (MAT2B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAT2B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MAT2B Antibody

Binding Specificity: Middle Region

Specificity: MAT2 B antibody was raised against the middle region of MAT2

Purification: Affinity purified

Immunogen: MAT2 B antibody was raised using the middle region of MAT2 corresponding to a region with amino acids GNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAT2B Blocking Peptide, (ABIN938837), is also available for use as a blocking control in assays to test for specificity of this MAT2B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAT2B

Target: MAT2B (Methionine Adenosyltransferase II, beta (MAT2B))

Alternative Name: MAT2B

Background: MAT2B belongs to the methionine adenosyltransferase (MAT) family. MAT catalyzes the biosynthesis of S-adenosylmethionine from methionine and ATP. This protein is the regulatory beta subunit of MAT.

Molecular Weight: 36 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process, Methionine Biosynthetic Process, SARS-CoV-2 Protein Interactome