RGS22 antibody (N-Term)

Catalog No. ABIN632062

This Rabbit Polyclonal antibody specifically detects RGS22 in WB. It exhibits reactivity toward Human.

Quick Overview for RGS22 antibody (N-Term) (ABIN632062)

Target: RGS22 (Regulator of G-Protein Signaling 22 (RGS22))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RGS22 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RGS22 Antibody

Binding Specificity: N-Term

Specificity: RGS22 antibody was raised against the N terminal of RGS22

Purification: Affinity purified

Immunogen: RGS22 antibody was raised using the N terminal of RGS22 corresponding to a region with amino acids QTVSTFSLPCCVPYNKLKSPAISSVSENFIFDDGVHPRTKKDPSKTNKLI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RGS22 Blocking Peptide, (ABIN5615847), is also available for use as a blocking control in assays to test for specificity of this RGS22 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS22 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RGS22

Target: RGS22 (Regulator of G-Protein Signaling 22 (RGS22))

Alternative Name: RGS22

Background: RGS22 inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form.

Molecular Weight: 147 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling