PI4K2B antibody (Middle Region)

Catalog No. ABIN632063

The Rabbit Polyclonal anti-PI4K2B antibody is suitable to detect PI4K2B in samples from Human. It has been validated for WB.

Quick Overview for PI4K2B antibody (Middle Region) (ABIN632063)

Target: PI4K2B (Phosphatidylinositol 4-Kinase Type 2 beta (PI4K2B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PI4K2B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PI4K2B Antibody

Binding Specificity: Middle Region

Specificity: PI4 K4 antibody was raised against the middle region of PI4 4

Purification: Affinity purified

Immunogen: PI4 K4 antibody was raised using the middle region of PI4 4 corresponding to a region with amino acids IIGVFKPKSEEPYGQLNPKWTKYVHKVCCPCCFGRGCLIPNQGYLSEAGA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PI4K2B Blocking Peptide, (ABIN939385), is also available for use as a blocking control in assays to test for specificity of this PI4K2B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PI0 0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PI4K2B

Target: PI4K2B (Phosphatidylinositol 4-Kinase Type 2 beta (PI4K2B))

Alternative Name: PI4K2B

Background: Phosphatidylinositol 4-kinases (PI4Ks) phosphorylate phosphatidylinositol to generate phosphatidylinositol 4-phosphate (PIP), an immediate precursor of several important signaling and scaffolding molecules.

Molecular Weight: 55 kDa (MW of target protein)

Pathways: Inositol Metabolic Process