Septin 9 antibody (Middle Region)

Catalog No. ABIN632098

This Rabbit Polyclonal antibody specifically detects Septin 9 in WB. It exhibits reactivity toward Human.

Quick Overview for Septin 9 antibody (Middle Region) (ABIN632098)

Target: Septin 9 (SEPT9)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Septin 9 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Septin 9 Antibody

Binding Specificity: Middle Region

Specificity: Septin 9 antibody was raised against the middle region of SEPT9

Purification: Affinity purified

Immunogen: Septin 9 antibody was raised using the middle region of SEPT9 corresponding to a region with amino acids VNEKFREMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHCEFAYL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Septin 9 Blocking Peptide, (ABIN5616053), is also available for use as a blocking control in assays to test for specificity of this Septin 9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 40057 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Septin 9

Target: Septin 9 (SEPT9)

Alternative Name: Septin 9

Background: This gene is a member of the septin family involved in cytokinesis and cell cycle control. This gene is a candidate for the ovarian tumor suppressor gene. Mutations in this gene cause hereditary neuralgic amyotrophy, also known as neuritis with brachial predilection. A chromosomal translocation involving this gene on chromosome 17 and the MLL gene on chromosome 11 results in acute myelomonocytic leukemia. Multiple alternatively spliced transcript variants encoding different isoforms have been described.

Molecular Weight: 46 kDa (MW of target protein)