RAI14 antibody (Middle Region)

Catalog No. ABIN632115

The Rabbit Polyclonal anti-RAI14 antibody (ABIN632115) specifically detects RAI14 in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for RAI14 antibody (Middle Region) (ABIN632115)

Target: RAI14 (Retinoic Acid Induced 14 (RAI14))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAI14 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RAI14 Antibody

Binding Specificity: Middle Region

Specificity: RAI14 antibody was raised against the middle region of RAI14

Purification: Affinity purified

Immunogen: RAI14 antibody was raised using the middle region of RAI14 corresponding to a region with amino acids LSQLYKEAQAELEDYRKRKSLEDVTAEYIHKAEHEKLMQLTNVSRAKAED

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAI14 Blocking Peptide, (ABIN5615746), is also available for use as a blocking control in assays to test for specificity of this RAI14 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAI14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAI14

Target: RAI14 (Retinoic Acid Induced 14 (RAI14))

Alternative Name: RAI14

Background: RAI14 contains 7 ANK repeats. The function of RAI14 remains unknown.

Molecular Weight: 110 kDa (MW of target protein)