EML1 antibody (C-Term)

Catalog No. ABIN632123

The Rabbit Polyclonal anti-EML1 antibody is suitable to detect EML1 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for EML1 antibody (C-Term) (ABIN632123)

Target: EML1 (Echinoderm Microtubule Associated Protein Like 1 (EML1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EML1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-EML1 Antibody

Binding Specificity: C-Term

Specificity: EML1 antibody was raised against the C terminal of EML1

Purification: Affinity purified

Immunogen: EML1 antibody was raised using the C terminal of EML1 corresponding to a region with amino acids YPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EML1 Blocking Peptide, (ABIN936166), is also available for use as a blocking control in assays to test for specificity of this EML1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EML1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EML1

Target: EML1 (Echinoderm Microtubule Associated Protein Like 1 (EML1))

Alternative Name: EML1

Background: Human echinoderm microtubule-associated protein-like is a strong candidate for the Usher syndrome type 1A gene. Usher syndromes (USHs) are a group of genetic disorders consisting of congenital deafness, retinitis pigmentosa, and vestibular dysfunction of variable onset and severity depending on the genetic type.

Molecular Weight: 92 kDa (MW of target protein)