VGLL3 antibody

Catalog No. ABIN632133

The Rabbit Polyclonal anti-VGLL3 antibody (ABIN632133) specifically detects VGLL3 in WB. The antibody is reactive with Human and Mouse samples.

Quick Overview for VGLL3 antibody (ABIN632133)

Target: VGLL3 (Vestigial Like 3 (VGLL3))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VGLL3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-VGLL3 Antibody

Purification: Affinity purified

Immunogen: VGLL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids CDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGLQHQDKSKESPWY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VGLL3 Blocking Peptide, (ABIN937049), is also available for use as a blocking control in assays to test for specificity of this VGLL3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VGLL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VGLL3

Target: VGLL3 (Vestigial Like 3 (VGLL3))

Alternative Name: VGLL3

Background: VGLL3 belongs to the vestigial family. It may act as a specific coactivator for the mammalian TEFs.

Molecular Weight: 36 kDa (MW of target protein)