ATG10 antibody

Catalog No. ABIN632157

The Rabbit Polyclonal anti-ATG10 antibody (ABIN632157) specifically detects ATG10 in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for ATG10 antibody (ABIN632157)

Target: ATG10 (Autophagy Related 10 (ATG10))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATG10 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ATG10 Antibody

Purification: Affinity purified

Immunogen: ATG10 antibody was raised using a synthetic peptide corresponding to a region with amino acids TPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ATG10 Blocking Peptide, (ABIN5612198), is also available for use as a blocking control in assays to test for specificity of this ATG10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATG10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ATG10

Target: ATG10 (Autophagy Related 10 (ATG10))

Alternative Name: ATG10

Background: Autophagy is a process for the bulk degradation of cytosolic compartments by lysosomes. ATG10 is an E2-like enzyme involved in 2 ubiquitin-like modifications essential for autophagosome formation: ATG12-ATG5 conjugation and modification of a soluble form of MAP-LC3 (MAP1LC3A), a homolog of yeast Apg8, to a membrane-bound form.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling, Autophagy