DNAJB1 antibody

Catalog No. ABIN632179

This Rabbit Polyclonal antibody specifically detects DNAJB1 in WB. It exhibits reactivity toward Human.

Quick Overview for DNAJB1 antibody (ABIN632179)

Target: DNAJB1 (DnaJ (Hsp40) Homolog, Subfamily B, Member 1 (DNAJB1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DNAJB1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DNAJB1 Antibody

Purification: Affinity purified

Immunogen: DNAJB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DNAJB1 Blocking Peptide, (ABIN938950), is also available for use as a blocking control in assays to test for specificity of this DNAJB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DNAJB1

Target: DNAJB1 (DnaJ (Hsp40) Homolog, Subfamily B, Member 1 (DNAJB1))

Alternative Name: DNAJB1

Background: DNAJB1 interacts with HSP70 and can stimulate its ATPase activity. It stimulates the association between HSC70 and HIP.

Molecular Weight: 38 kDa (MW of target protein)