FGFR1OP antibody (Middle Region)

Catalog No. ABIN632197

This Rabbit Polyclonal antibody specifically detects FGFR1OP in WB. It exhibits reactivity toward Human.

Quick Overview for FGFR1OP antibody (Middle Region) (ABIN632197)

Target: FGFR1OP (FGFR1 Oncogene Partner (FGFR1OP))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FGFR1OP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FGFR1OP Antibody

Binding Specificity: Middle Region

Specificity: FGFR1 OP antibody was raised against the middle region of FGFR1 P

Purification: Affinity purified

Immunogen: FGFR1 OP antibody was raised using the middle region of FGFR1 P corresponding to a region with amino acids LSDVHSPPKSPEGKTSAQTTPSKIPRYKGQGKKKTSGQKAGDKKANDEAN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FGFR1OP Blocking Peptide, (ABIN5613578), is also available for use as a blocking control in assays to test for specificity of this FGFR1OP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGFR0 P antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FGFR1OP

Target: FGFR1OP (FGFR1 Oncogene Partner (FGFR1OP))

Alternative Name: FGFR1OP

Background: FGFR1OP is a largely hydrophilic protein postulated to be a leucine-rich protein family member. A t (6,8)(q27,p11) chromosomal translocation, fusing this gene and the fibroblast growth factor receptor 1 (FGFR1) gene, has been found in cases of myeloproliferative disorder. The resulting chimeric protein contains the N-terminal leucine-rich region of this encoded protein fused to the catalytic domain of FGFR1.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: M Phase, Maintenance of Protein Location, SARS-CoV-2 Protein Interactome