ANKRD13B antibody (Middle Region)

Catalog No. ABIN632215

This Rabbit Polyclonal antibody specifically detects ANKRD13B in WB. It exhibits reactivity toward Human and Rat.

Quick Overview for ANKRD13B antibody (Middle Region) (ABIN632215)

Target: ANKRD13B (Ankyrin Repeat Domain 13B (ANKRD13B))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ANKRD13B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ANKRD13B Antibody

Binding Specificity: Middle Region

Specificity: ANKRD13 B antibody was raised against the middle region of ANKRD13

Purification: Affinity purified

Immunogen: ANKRD13 B antibody was raised using the middle region of ANKRD13 corresponding to a region with amino acids HPMSYEGRRQDRSAPPTPQRQPAPPASVPSPRPSSGPGSGGHVFRSYDEQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ANKRD13B Blocking Peptide, (ABIN939200), is also available for use as a blocking control in assays to test for specificity of this ANKRD13B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKRD10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ANKRD13B

Target: ANKRD13B (Ankyrin Repeat Domain 13B (ANKRD13B))

Alternative Name: ANKRD13B

Background: The function of ANKRD13B protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 70 kDa (MW of target protein)