PAICS antibody (N-Term)

Catalog No. ABIN632240

The Rabbit Polyclonal anti-PAICS antibody is suitable to detect PAICS in samples from Human and Mouse. It has been validated for WB.

Quick Overview for PAICS antibody (N-Term) (ABIN632240)

Target: PAICS (phosphoribosylaminoimidazole Carboxylase, phosphoribosylaminoimidazole Succinocarboxamide Synthetase (PAICS))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PAICS antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PAICS Antibody

Binding Specificity: N-Term

Specificity: PAICS antibody was raised against the N terminal of PAICS

Purification: Affinity purified

Immunogen: PAICS antibody was raised using the N terminal of PAICS corresponding to a region with amino acids ATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PAICS Blocking Peptide, (ABIN936933), is also available for use as a blocking control in assays to test for specificity of this PAICS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAICS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PAICS

Target: PAICS (phosphoribosylaminoimidazole Carboxylase, phosphoribosylaminoimidazole Succinocarboxamide Synthetase (PAICS))

Alternative Name: PAICS

Background: PAICS is a bifunctional enzyme containing phosphoribosylaminoimidazole carboxylase activity in its N-terminal region and phosphoribosylaminoimidazole succinocarboxamide synthetase in its C-terminal region. It catalyzes steps 6 and 7 of purine biosynthesis.

Molecular Weight: 47 kDa (MW of target protein)

Pathways: Chromatin Binding