VPS54 antibody

Catalog No. ABIN632263

This Rabbit Polyclonal antibody specifically detects VPS54 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for VPS54 antibody (ABIN632263)

Target: VPS54 (Vacuolar Protein Sorting 54 Homolog (VPS54))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VPS54 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-VPS54 Antibody

Purification: Affinity purified

Immunogen: VPS54 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYLPQISKEHFTVYQQEISQREKIHERCKNICPPKDTFERTLLHTHDKSR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VPS54 Blocking Peptide, (ABIN938525), is also available for use as a blocking control in assays to test for specificity of this VPS54 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS54 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VPS54

Target: VPS54 (Vacuolar Protein Sorting 54 Homolog (VPS54))

Alternative Name: VPS54

Background: VPS54 may be involved in retrograde transport from early and late endosomes to late Golgi.

Molecular Weight: 107 kDa (MW of target protein)