SAMD4A antibody (Middle Region)

Catalog No. ABIN632312

The Rabbit Polyclonal anti-SAMD4A antibody is suitable to detect SAMD4A in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for SAMD4A antibody (Middle Region) (ABIN632312)

Target: SAMD4A (Sterile alpha Motif Domain Containing 4A (SAMD4A))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SAMD4A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SAMD4A Antibody

Binding Specificity: Middle Region

Specificity: SAMD4 A antibody was raised against the middle region of SAMD4

Purification: Affinity purified

Immunogen: SAMD4 A antibody was raised using the middle region of SAMD4 corresponding to a region with amino acids LKSLRLHKYAALFSQMTYEEMMALTECQLEAQNVTKGARHKIVISIQKLK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SAMD4A Blocking Peptide, (ABIN940492), is also available for use as a blocking control in assays to test for specificity of this SAMD4A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAMD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SAMD4A

Target: SAMD4A (Sterile alpha Motif Domain Containing 4A (SAMD4A))

Alternative Name: SAMD4A

Background: Sterile alpha motifs (SAMs) in proteins such as SAMD4A are part of an RNA-binding domain that functions as a posttranscriptional regulator by binding to an RNA sequence motif known as the Smaug recognition element, which was named after the Drosophila Smaug protein.

Molecular Weight: 79 kDa (MW of target protein)