FAS antibody

Catalog No. ABIN632316

The Rabbit Polyclonal anti-FAS antibody (ABIN632316) specifically detects FAS in WB. The antibody is reactive with Human samples.

Quick Overview for FAS antibody (ABIN632316)

Target: FAS (TNF Receptor Superfamily, Member 6 (FAS))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAS antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FAS Antibody

Purification: Affinity purified

Immunogen: FAS antibody was raised using a synthetic peptide corresponding to a region with amino acids KKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAS Blocking Peptide, (ABIN939841), is also available for use as a blocking control in assays to test for specificity of this FAS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAS

Target: FAS (TNF Receptor Superfamily, Member 6 (FAS))

Alternative Name: FAS

Background: FAS is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system.

Molecular Weight: 36 kDa (MW of target protein)

Pathways: p53 Signaling, Apoptosis, Production of Molecular Mediator of Immune Response, Positive Regulation of Endopeptidase Activity