USP12 antibody (Middle Region)

Catalog No. ABIN632371

This Rabbit Polyclonal antibody specifically detects USP12 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for USP12 antibody (Middle Region) (ABIN632371)

Target: USP12 (Ubiquitin Specific Peptidase 12 (USP12))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This USP12 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-USP12 Antibody

Binding Specificity: Middle Region

Specificity: USP12 antibody was raised against the middle region of USP12

Purification: Affinity purified

Immunogen: USP12 antibody was raised using the middle region of USP12 corresponding to a region with amino acids ITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

USP12 Blocking Peptide, (ABIN939573), is also available for use as a blocking control in assays to test for specificity of this USP12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of USP12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for USP12

Target: USP12 (Ubiquitin Specific Peptidase 12 (USP12))

Alternative Name: USP12

Background: USP12 is a deubiquitinating enzyme. USP12 has almost no deubiquitinating activity by itself and requires the interaction with WDR48 to have a high activity. USP12 is not involved in deubiquitination of monoubiquitinated FANCD2.

Molecular Weight: 43 kDa (MW of target protein)