VPS52 antibody

Catalog No. ABIN632392

This Rabbit Polyclonal antibody specifically detects VPS52 in WB. It exhibits reactivity toward Human.

Quick Overview for VPS52 antibody (ABIN632392)

Target: VPS52 (Vacuolar Protein Sorting 52 Homolog (VPS52))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VPS52 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-VPS52 Antibody

Purification: Affinity purified

Immunogen: VPS52 antibody was raised using a synthetic peptide corresponding to a region with amino acids RYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGGLDTRPHYITRRYAEF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VPS52 Blocking Peptide, (ABIN5616981), is also available for use as a blocking control in assays to test for specificity of this VPS52 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS52 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VPS52

Target: VPS52 (Vacuolar Protein Sorting 52 Homolog (VPS52))

Alternative Name: VPS52

Background: This gene encodes a protein that is similar to the yeast suppressor of actin mutations 2 gene. The yeast protein forms a subunit of the tetrameric Golgi-associated retrograde protein complex that is involved in vesicle trafficking from from both early and late endosomes, back to the trans-Golgi network. This gene is located on chromosome 6 in a head-to-head orientation with the gene encoding ribosomal protein S18.

Molecular Weight: 82 kDa (MW of target protein)