Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Eukaryotic Translation Initiation Factor 5A2 (EIF5A2) antibody

Antigen

Eukaryotic Translation Initiation Factor 5A2 (EIF5A2)
Synonyms eIF5AII, MGC124092, MGC124093, 9630038B20, EIF-5A2, EIF5A2, DKFZp469D034, EIF5A, zgc:55504, zgc:77429, wu:fb05b06, wu:fc23f04, wu:fc61c10
Clonality Polyclonal
Host
Alternatives

Rabbit
Application
Alternatives Western Blotting (WB)
Catalog no. ABIN632450
Quantity 50 ug  (1 mg/ml)  (Variants)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information
Application Details Alternatives Secondary Antibodies Variants back to top

Alternative name EIF5A2
Immunogen EIF5A2 antibody was raised using the N terminal of EIF5A2 corresponding to a region with amino acids MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGK
Description EIF5A2 is a mRNA-binding protein involved in translation elongation. EIF5A2 has an important function at the level of mRNA turnover, probably acting downstream of decapping.
Molecular Weight 17 kDa (MW of target protein)

Application Details
Alternatives Secondary Antibodies Variants back to top

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EIF5A2 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Restrictions For Research Use only

Alternatives
Application Details Secondary Antibodies Variants back to top

Alternatives for antigen "Eukaryotic Translation Initiation Factor 5A2 (EIF5A2)", type "Antibodies"
Hosts Rabbit (6), Mouse (5)
Reactivities Human (13)
Applications Western Blotting (WB) (13), Immunofluorescence (IF) (5), ELISA (4), ELISA (Detection) (3), Enzyme Immunoassay (EIA) (3), Flow Cytometry (FACS) (1), Immunohistochemistry (Frozen Sections) (IHC (fro)) (1), Immunohistochemistry (IHC) (1), Immunoprecipitation (IP) (1)