TGM3 antibody

Catalog No. ABIN632498

The Rabbit Polyclonal anti-TGM3 antibody is suitable to detect TGM3 in samples from Human. It has been validated for WB.

Quick Overview for TGM3 antibody (ABIN632498)

Target: TGM3 (Transglutaminase 3 (E Polypeptide, Protein-Glutamine-gamma-Glutamyltransferase) (TGM3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TGM3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TGM3 Antibody

Purification: Affinity purified

Immunogen: Transglutaminase 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAALGVQSINWQTAFNRQAHHTDKFSSQELILRRGQNFQVLMIMNKGLGS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Transglutaminase 3 Blocking Peptide, (ABIN5616759), is also available for use as a blocking control in assays to test for specificity of this Transglutaminase 3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGM3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TGM3

Target: TGM3 (Transglutaminase 3 (E Polypeptide, Protein-Glutamine-gamma-Glutamyltransferase) (TGM3))

Alternative Name: Transglutaminase 3

Background: Transglutaminases are enzymes that catalyze the crosslinking of proteins by epsilon-gamma glutamyl lysine isopeptide bonds.

Molecular Weight: 25 kDa (MW of target protein)