LDHAL6B antibody (Middle Region)

Catalog No. ABIN632531

The Rabbit Polyclonal anti-LDHAL6B antibody is suitable to detect LDHAL6B in samples from Human. It has been validated for WB.

Quick Overview for LDHAL6B antibody (Middle Region) (ABIN632531)

Target: LDHAL6B (Lactate Dehydrogenase A-Like 6B (LDHAL6B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LDHAL6B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LDHAL6B Antibody

Binding Specificity: Middle Region

Specificity: LDHAL6 B antibody was raised against the middle region of LDHAL6

Purification: Affinity purified

Immunogen: LDHAL6 B antibody was raised using the middle region of LDHAL6 corresponding to a region with amino acids SGVNIAGVPLKDLNSDIGTDKDPEQWKNVHKEVTATAYEIIKMKGYTSWA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LDHAL6B Blocking Peptide, (ABIN5614433), is also available for use as a blocking control in assays to test for specificity of this LDHAL6B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LDHAL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LDHAL6B

Target: LDHAL6B (Lactate Dehydrogenase A-Like 6B (LDHAL6B))

Alternative Name: LDHAL6B

Background: The function of LDH protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 42 kDa (MW of target protein)