SENP2 antibody (Middle Region)

Catalog No. ABIN632554

This Rabbit Polyclonal antibody specifically detects SENP2 in WB. It exhibits reactivity toward Human.

Quick Overview for SENP2 antibody (Middle Region) (ABIN632554)

Target: SENP2 (SUMO1/sentrin/SMT3 Specific Peptidase 2 (SENP2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SENP2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SENP2 Antibody

Binding Specificity: Middle Region

Specificity: SENP2 antibody was raised against the middle region of SENP2

Purification: Affinity purified

Immunogen: SENP2 antibody was raised using the middle region of SENP2 corresponding to a region with amino acids RICEILLQYLQDESKTKRNSDLNLLEWTHHSMKPHEIPQQLNGSDCGMFT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SENP2 Blocking Peptide, (ABIN5616042), is also available for use as a blocking control in assays to test for specificity of this SENP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SENP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SENP2

Target: SENP2 (SUMO1/sentrin/SMT3 Specific Peptidase 2 (SENP2))

Alternative Name: SENP2

Background: SUMO1 is a small ubiquitin-like protein that can be covalently conjugated to other proteins. SENP2 is one of a group of enzymes that process newly synthesized SUMO1 into the conjugatable form and catalyze the deconjugation of SUMO1-containing species.

Molecular Weight: 68 kDa (MW of target protein)

Pathways: Chromatin Binding