SDCCAG8 antibody (N-Term)

Catalog No. ABIN632575

This Rabbit Polyclonal antibody specifically detects SDCCAG8 in WB. It exhibits reactivity toward Human.

Quick Overview for SDCCAG8 antibody (N-Term) (ABIN632575)

Target: SDCCAG8 (serologically Defined Colon Cancer Antigen 8 (SDCCAG8))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SDCCAG8 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SDCCAG8 Antibody

Binding Specificity: N-Term

Specificity: SDCCAG8 antibody was raised against the N terminal of SDCCAG8

Purification: Affinity purified

Immunogen: SDCCAG8 antibody was raised using the N terminal of SDCCAG8 corresponding to a region with amino acids HEETNMPTMHDLVHTINDQSQYIHHLEAEVKFCKEELSGMKNKIQVVVLE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SDCCAG8 Blocking Peptide, (ABIN939102), is also available for use as a blocking control in assays to test for specificity of this SDCCAG8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDCCAG8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SDCCAG8

Target: SDCCAG8 (serologically Defined Colon Cancer Antigen 8 (SDCCAG8))

Alternative Name: SDCCAG8

Background: SDCCAG8 encodes a centrosome associated protein. This protein may be involved in organizing the centrosome during interphase and mitosis. Mutations in this gene are associated with retinal-renal ciliopathy.

Molecular Weight: 83 kDa (MW of target protein)

Pathways: M Phase, Tube Formation