RALB antibody

Catalog No. ABIN632601

The Rabbit Polyclonal anti-RALB antibody (ABIN632601) specifically detects RALB in WB. The antibody is reactive with Human samples.

Quick Overview for RALB antibody (ABIN632601)

Target: RALB (Ralb) (V-Ral Simian Leukemia Viral Oncogene Homolog B (Ras Related, GTP Binding Protein) (Ralb))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RALB antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RALB Antibody

Purification: Affinity purified

Immunogen: RALB antibody was raised using a synthetic peptide corresponding to a region with amino acids FREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RALB Blocking Peptide, (ABIN938430), is also available for use as a blocking control in assays to test for specificity of this RALB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RALB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RALB

Target: RALB (Ralb) (V-Ral Simian Leukemia Viral Oncogene Homolog B (Ras Related, GTP Binding Protein) (Ralb))

Alternative Name: RALB

Background: This gene encodes a GTP-binding protein that belongs to the small GTPase superfamily and Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors.

Molecular Weight: 23 kDa (MW of target protein)

Pathways: Neurotrophin Signaling Pathway, CXCR4-mediated Signaling Events