MMADHC antibody

Catalog No. ABIN632628

The Rabbit Polyclonal anti-MMADHC antibody (ABIN632628) specifically detects MMADHC in WB. The antibody is reactive with Human samples.

Quick Overview for MMADHC antibody (ABIN632628)

Target: MMADHC (Methylmalonic Aciduria (Cobalamin Deficiency) CblD Type, with Homocystinuria (MMADHC))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MMADHC antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MMADHC Antibody

Purification: Affinity purified

Immunogen: C2 orf25 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSSGSDESHVAAAPPDICSRTVWPDETMGPFGPQDQRFQLPGNIGFDCHL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C2orf25 Blocking Peptide, (ABIN938972), is also available for use as a blocking control in assays to test for specificity of this C2orf25 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 rf25 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MMADHC

Target: MMADHC (Methylmalonic Aciduria (Cobalamin Deficiency) CblD Type, with Homocystinuria (MMADHC))

Alternative Name: C2orf25

Background: Vitamin B12 (cobalamin) is an essential cofactor in several metabolic pathways. Intracellular conversion of cobalamin to adenosylcobalamin in mitochondria and to methylcobalamin in cytoplasm is necessary for homeostasis of methylmalonic acid and homocysteine. C2ORF25 encodes a protein involved in an early step of cobalamin metabolism.

Molecular Weight: 33 kDa (MW of target protein)