THNSL2 antibody

Catalog No. ABIN632635

This Rabbit Polyclonal antibody specifically detects THNSL2 in WB. It exhibits reactivity toward Human.

Quick Overview for THNSL2 antibody (ABIN632635)

Target: THNSL2 (threonine Synthase-Like 2 (THNSL2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This THNSL2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-THNSL2 Antibody

Purification: Affinity purified

Immunogen: THNSL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPLVEVVVPTGAAGNLAAGYIAQKIGLPIRLVVAVNRNDIIHRTVQQGDF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

THNSL2 Blocking Peptide, (ABIN5616587), is also available for use as a blocking control in assays to test for specificity of this THNSL2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THNSL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for THNSL2

Target: THNSL2 (threonine Synthase-Like 2 (THNSL2))

Alternative Name: THNSL2

Background: THNSL2 dDegrades O-phospho-threonine (PThr) to alpha-ketobutyrate, ammonia and phosphate.

Molecular Weight: 54 kDa (MW of target protein)