PGAM2 antibody

Catalog No. ABIN632675

The Rabbit Polyclonal anti-PGAM2 antibody is suitable to detect PGAM2 in samples from Human. It has been validated for WB.

Quick Overview for PGAM2 antibody (ABIN632675)

Target: PGAM2 (phosphoglycerate Mutase 2 (Muscle) (PGAM2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PGAM2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PGAM2 Antibody

Purification: Affinity purified

Immunogen: PGAM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKAIKDAKM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PGAM2 Blocking Peptide, (ABIN5615328), is also available for use as a blocking control in assays to test for specificity of this PGAM2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGAM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PGAM2

Target: PGAM2 (phosphoglycerate Mutase 2 (Muscle) (PGAM2))

Alternative Name: PGAM2

Background: PGAM2 is the interconversion of 3- and 2-phosphoglycerate with 2,3-bisphosphoglycerate as the primer of the reaction. It can also catalyze the reaction of EC 5.4.2.4 (synthase) and EC 3.1.3.13 (phosphatase), but with a reduced activity.

Molecular Weight: 29 kDa (MW of target protein)