Hsc70 antibody (N-Term)

Catalog No. ABIN632682

The Rabbit Polyclonal anti-Hsc70 antibody (ABIN632682) specifically detects Hsc70 in WB. The antibody is reactive with Human, Rat, Mouse, Dog, Drosophila melanogaster, C. elegans and Arabidopsis samples.

Quick Overview for Hsc70 antibody (N-Term) (ABIN632682)

Target: Hsc70 (HSPA8) (Heat Shock 70kDa Protein 8 (HSPA8))

Reactivity: Human, Rat, Mouse, Dog, Drosophila melanogaster, C. elegans, Arabidopsis

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Hsc70 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Hsc70 Antibody

Binding Specificity: N-Term

Specificity: HSPA8 antibody was raised against the N terminal of HSPA8

Purification: Affinity purified

Immunogen: HSPA8 antibody was raised using the N terminal of HSPA8 corresponding to a region with amino acids VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HSPA8 Blocking Peptide, (ABIN5614101), is also available for use as a blocking control in assays to test for specificity of this HSPA8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Hsc70

Target: Hsc70 (HSPA8) (Heat Shock 70kDa Protein 8 (HSPA8))

Alternative Name: HSPA8

Background: HSPA8 belongs to the heat shock protein 70 family which contains both heat-inducible and constitutively expressed members. The latter are called heat-shock cognate proteins. HSPA8 is a heat-shock cognate protein.

Molecular Weight: 71 kDa (MW of target protein)