Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

N-Acylneuraminate-9-Phosphatase (NANP) antibody

Antigen

N-Acylneuraminate-9-Phosphatase (NANP)
Synonyms HDHD4, MGC26833, C20orf147, dJ694B14.3, Hdhd4, MGC103377, 1600031M04Rik, A130094D17Rik, MGC105812, RGD1306009
Clonality Polyclonal
Host
Alternatives

Rabbit
Application
Alternatives Western Blotting (WB)
Catalog no. ABIN632748
Quantity 50 ug  (1 mg/ml)  (Variants)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information
Application Details Alternatives Secondary Antibodies Variants back to top

Alternative name NANP
Immunogen NANP antibody was raised using the middle region of NANP corresponding to a region with amino acids VQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVS
Description The function of NANP protein is not widely studied, and is yet to be elucidated fully.
Molecular Weight 28 kDa (MW of target protein)

Application Details
Alternatives Secondary Antibodies Variants back to top

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NANP antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Signaling, Metabolism, Enzymes

Alternatives
Application Details Secondary Antibodies Variants back to top

Alternatives for antigen "N-Acylneuraminate-9-Phosphatase (NANP)", type "Antibodies"
Hosts Mouse (7), Rabbit (6)
Reactivities Human (10), Mouse (Murine) (1)
Applications Western Blotting (WB) (7), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (6), Immunofluorescence (IF) (5), ELISA (Detection) (2), Flow Cytometry (FACS) (2)
Epitopes N-Term (1)