PGBD2 antibody (Middle Region)

Catalog No. ABIN632783

The Rabbit Polyclonal anti-PGBD2 antibody is suitable to detect PGBD2 in samples from Human. It has been validated for WB.

Quick Overview for PGBD2 antibody (Middle Region) (ABIN632783)

Target: PGBD2 (PiggyBac Transposable Element Derived 2 (PGBD2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PGBD2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PGBD2 Antibody

Binding Specificity: Middle Region

Specificity: PGBD2 antibody was raised against the middle region of PGBD2

Purification: Affinity purified

Immunogen: PGBD2 antibody was raised using the middle region of PGBD2 corresponding to a region with amino acids RICCQDAQVDLLAFRRYIACVYLESNADTTSQGRRSRRLETESRFDMIGH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PGBD2 Blocking Peptide, (ABIN5615329), is also available for use as a blocking control in assays to test for specificity of this PGBD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGBD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PGBD2

Target: PGBD2 (PiggyBac Transposable Element Derived 2 (PGBD2))

Alternative Name: PGBD2

Background: The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. The exact function of this gene is not known.

Molecular Weight: 39 kDa (MW of target protein)