Heat Shock 10kDa Protein 1 (Chaperonin 10) (HSPE1) antibody

Antigen: Heat Shock 10kDa Protein 1 (Chaperonin 10) (HSPE1)

Synonyms: CPN10, GROES, HSP10, groS, Cpn10, cpn10, zgc:86747, HSPE1, MGC79030, hspe1, MGC89647, CHLOROPLAST CHAPERONIN 10, F16B22.14, ATCPN21, CHAPERONIN 10, CHAPERONIN 20, CHCPN10, CPN20, CPN21, T1M15.120, T1M15_120, MITOCHONDRIAL CHAPERONIN 10, T15D22.2, T15D22_2, anon-WO0118547.175, DmelCG11267, Hsp10, hsp10, crpB, chpS

Clonality: Polyclonal

Host: Rabbit

Application: Western Blotting (WB)

Catalog no.: ABIN632792

Additional Information

Alternative name: HSPE1

Immunogen: HSPE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD

Description: HSPE1 is a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner.

Molecular Weight: 11 kDa (MW of target protein)

Synonyms: CPN10, GROES, HSP10, groS, Cpn10, cpn10, zgc:86747, HSPE1, MGC79030, hspe1, MGC89647, CHLOROPLAST CHAPERONIN 10, F16B22.14, ATCPN21, CHAPERONIN 10, CHAPERONIN 20, CHCPN10, CPN20, CPN21, T1M15.120, T1M15_120, MITOCHONDRIAL CHAPERONIN 10, T15D22.2, T15D22_2, anon-WO0118547.175, DmelCG11267, Hsp10, hsp10, crpB, chpS

Application Details

Concentration: 1 mg/ml

Purification: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HSPE1 antibody in PBS

Storage: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.