PPWD1 antibody (Middle Region)

Catalog No. ABIN632810

The Rabbit Polyclonal anti-PPWD1 antibody is suitable to detect PPWD1 in samples from Human, Rat and Mouse. It has been validated for WB.

Quick Overview for PPWD1 antibody (Middle Region) (ABIN632810)

Target: PPWD1 (Peptidylprolyl Isomerase Domain and WD Repeat Containing 1 (PPWD1))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPWD1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PPWD1 Antibody

Binding Specificity: Middle Region

Specificity: PPWD1 antibody was raised against the middle region of PPWD1

Purification: Affinity purified

Immunogen: PPWD1 antibody was raised using the middle region of PPWD1 corresponding to a region with amino acids FMIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPWD1 Blocking Peptide, (ABIN938384), is also available for use as a blocking control in assays to test for specificity of this PPWD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPWD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPWD1

Target: PPWD1 (Peptidylprolyl Isomerase Domain and WD Repeat Containing 1 (PPWD1))

Alternative Name: PPWD1

Background: PPWD1 is a putative peptidylprolyl isomerase (PPIase). PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPWD1 may be involved in pre-mRNA splicing.

Molecular Weight: 73 kDa (MW of target protein)