HARBI1 antibody (Middle Region)

Catalog No. ABIN632839

This Rabbit Polyclonal antibody specifically detects HARBI1 in WB. It exhibits reactivity toward Mouse, Human and Rat.

Quick Overview for HARBI1 antibody (Middle Region) (ABIN632839)

Target: HARBI1 (Harbinger Transposase Derived 1 (HARBI1))

Reactivity: Mouse, Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HARBI1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HARBI1 Antibody

Binding Specificity: Middle Region

Specificity: C11 ORF77 antibody was raised against the middle region of C11 rf77

Purification: Affinity purified

Immunogen: C11 ORF77 antibody was raised using the middle region of C11 rf77 corresponding to a region with amino acids GVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSLNCLMVCDIRGTLMTVETN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C11ORF77 Blocking Peptide, (ABIN939031), is also available for use as a blocking control in assays to test for specificity of this C11ORF77 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF77 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HARBI1

Target: HARBI1 (Harbinger Transposase Derived 1 (HARBI1))

Alternative Name: C11ORF77

Background: The function of Chromosome 11 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 39 kDa (MW of target protein)