VPS54 antibody

Catalog No. ABIN632870

The Rabbit Polyclonal anti-VPS54 antibody is suitable to detect VPS54 in samples from Human and Rat. It has been validated for WB.

Quick Overview for VPS54 antibody (ABIN632870)

Target: VPS54 (Vacuolar Protein Sorting 54 Homolog (VPS54))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VPS54 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-VPS54 Antibody

Purification: Affinity purified

Immunogen: VPS54 antibody was raised using a synthetic peptide corresponding to a region with amino acids FNSVLPWSHFNTAGGKGNRDAASSKLLQEKLSHYLDIVEVNIAHQISLRS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VPS54 Blocking Peptide, (ABIN938397), is also available for use as a blocking control in assays to test for specificity of this VPS54 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS54 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VPS54

Target: VPS54 (Vacuolar Protein Sorting 54 Homolog (VPS54))

Alternative Name: VPS54

Background: VPS54 may be involved in retrograde transport from early and late endosomes to late Golgi. This gene encodes for a protein that in yeast forms part of a trimeric vacuolar-protein-sorting complex that is required for retrograde transport of proteins from prevacuoles to the late Golgi compartment. As in yeast, mammalian Vps54 proteins contain a coiled-coil region and dileucine motifs. Alternative splicing results in multiple transcript variants encoding different isoforms.

Molecular Weight: 107 kDa (MW of target protein)