TASP1 antibody (Middle Region)

Catalog No. ABIN632927

The Rabbit Polyclonal anti-TASP1 antibody is suitable to detect TASP1 in samples from Human. It has been validated for WB.

Quick Overview for TASP1 antibody (Middle Region) (ABIN632927)

Target: TASP1 (Taspase, Threonine Aspartase, 1 (TASP1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TASP1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TASP1 Antibody

Binding Specificity: Middle Region

Specificity: TASP1 antibody was raised against the middle region of TASP1

Purification: Affinity purified

Immunogen: TASP1 antibody was raised using the middle region of TASP1 corresponding to a region with amino acids QNKQTLLVEFLWSHTTESMCVGYMSAQDGKAKTHISRLPPGAVAGQSVAI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TASP1 Blocking Peptide, (ABIN5616507), is also available for use as a blocking control in assays to test for specificity of this TASP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TASP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TASP1

Target: TASP1 (Taspase, Threonine Aspartase, 1 (TASP1))

Alternative Name: TASP1

Background: This gene encodes an endopeptidase that cleaves specific substrates following aspartate residues. The encoded protein undergoes posttranslational autoproteolytic processing to generate alpha and beta subunits.

Molecular Weight: 19 kDa (MW of target protein)