RAB22A antibody (Middle Region)

Catalog No. ABIN632952

The Rabbit Polyclonal anti-RAB22A antibody (ABIN632952) specifically detects RAB22A in WB. The antibody is reactive with Human samples.

Quick Overview for RAB22A antibody (Middle Region) (ABIN632952)

Target: RAB22A (RAB22A, Member RAS Oncogene Family (RAB22A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAB22A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RAB22A Antibody

Binding Specificity: Middle Region

Specificity: RAB22 A antibody was raised against the middle region of RAB22

Purification: Affinity purified

Immunogen: RAB22 A antibody was raised using the middle region of RAB22 corresponding to a region with amino acids IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAB22A Blocking Peptide, (ABIN939350), is also available for use as a blocking control in assays to test for specificity of this RAB22A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAB22A

Target: RAB22A (RAB22A, Member RAS Oncogene Family (RAB22A))

Alternative Name: RAB22A

Background: The protein encoded by this gene is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosom

Molecular Weight: 22 kDa (MW of target protein)